Recombinant Human LIPH, His-tagged

Cat.No. : LIPH-127H
Product Overview : Recombinant Human Lipase Member H/LIPH is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu19-Leu451) of Human LIPH fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 19-451 a.a.
Description : Lipase Member H (LIPH) is a secreted protein that is a member of the Lipase family of AB hydrolase superfamily. LIPH catalyzes the production of 2-acyl lysophosphatidic acid (LPA), which is a lipid mediator with diverse biological properties that include platelet aggregation, smooth muscle contraction, and stimulation of cell proliferation and motility. However, LIPH does not hydrolyze other phospholipids, like phosphatidylserine (PS), phosphatidylcholine (PC) and phosphatidylethanolamine (PE) or triacylglycerol (TG).
AA Sequence : EETCPSFTRLSFHSAVVGTGLNVRLMLYTRKNLTCAQTINSS AFGNLNVTKKTTFIVHGFRPT GSPPVWMDDLVKGLLSVEDMNVVVVDWNRGATTLIYTHASSKTRKVAMVLKEFIDQMLAEGASLD DIYMIGVSLGAHISGFVGEMYDGWLGRITGLDPAGPLFNGKPHQDRLDPSDAQFVDVIHSDTDAL GYKEPLGNIDFYPNGGLDQPGCPKTILGGFQYFKCDHQRSVYLYLSSLRESCTITAYPCDSYQDY RNGKCVSCGTSQKESCPLLGYYADNWKDHLRGKDPPMTKAFFDTAEESPFCMYHYFVDIITWNKN VRRGDITIKLRDKAGNTTESKINHEPTTFQKYHQVSLLARFNQDLDKVAAISLMFSTGSLIGPRY KLRILRMKLRSLAHPERPQLCRYDLVLMENVETVFQPILCPELQL
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name LIPH lipase, member H [ Homo sapiens ]
Official Symbol LIPH
Synonyms LIPH; lipase, member H; lipase member H; mPA PLA1; PLA1B; lipase H; mPA-PLA1 alpha; phospholipase A1 member B; LPD lipase-related protein; membrane-bound phosphatidic acid-selective phospholipase A1; membrane-associated phosphatidic acid-selective phospholipase A1-alpha; AH; LAH2; ARWH2; LPDLR; mPA-PLA1;
Gene ID 200879
mRNA Refseq NM_139248
Protein Refseq NP_640341
MIM 607365
UniProt ID Q8WWY8
Chromosome Location 3q27
Function heparin binding; hydrolase activity; phospholipase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LIPH Products

Required fields are marked with *

My Review for All LIPH Products

Required fields are marked with *

0

Inquiry Basket

cartIcon