Recombinant Human LIPF Protein, GST-tagged

• Cat.No.: LIPF-05H
• Product Overview: Human LIPF partial ORF (299 a.a. - 398 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 299-398
• Description: This gene encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism. Several transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 36.74 kDa
• AA Sequence: KSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LIPF lipase F, gastric type [ Homo sapiens (human) ]
• Official Symbol: LIPF
• Synonyms: LIPF; lipase F, gastric type; GL; HGL; HLAL; gastric triacylglycerol lipase; gastric lipase; lipase, gastric; EC 3.1.1.3
• Gene ID: 8513
• mRNA Refseq: NM_004190
• Protein Refseq: NP_004181
• MIM: 601980
• UniProt ID: P07098