Recombinant Human LINC01521 Protein, GST-tagged

• Cat.No.: LINC01521-4261H
• Product Overview: Human FLJ20464 full-length ORF ( CAK54489.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: LINC01521 (Long Intergenic Non-Protein Coding RNA 1521) is an RNA Gene, and is affiliated with the non-coding RNA class.
• Molecular Mass: 41.14 kDa
• AA Sequence: MREIPRSRLRPPPCFKHQRGPGVLAGDRPNLRSCFCTRYIDRSDGLRARKSWRDEASVQLLPQTTARRALSPGSVKSPAPGGDNMRAMDGAGTPGSPSNPQGSGGAGGVGDTLRPLQARSIPSARSPVRRRVLW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LINC01521 long intergenic non-protein coding RNA 1521 [ Homo sapiens (human) ]
• Official Symbol: LINC01521
• Synonyms: LINC01521; long intergenic non-protein coding RNA 1521
• Gene ID: 54944