Recombinant Human LINC01521 Protein, GST-tagged

Cat.No. : LINC01521-4261H
Product Overview : Human FLJ20464 full-length ORF ( CAK54489.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : LINC01521 (Long Intergenic Non-Protein Coding RNA 1521) is an RNA Gene, and is affiliated with the non-coding RNA class.
Molecular Mass : 41.14 kDa
AA Sequence : MREIPRSRLRPPPCFKHQRGPGVLAGDRPNLRSCFCTRYIDRSDGLRARKSWRDEASVQLLPQTTARRALSPGSVKSPAPGGDNMRAMDGAGTPGSPSNPQGSGGAGGVGDTLRPLQARSIPSARSPVRRRVLW
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LINC01521 long intergenic non-protein coding RNA 1521 [ Homo sapiens (human) ]
Official Symbol LINC01521
Synonyms LINC01521; long intergenic non-protein coding RNA 1521;
Gene ID 54944

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LINC01521 Products

Required fields are marked with *

My Review for All LINC01521 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon