Recombinant Human LIN7C Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LIN7C-5844H
• Product Overview: LIN7C MS Standard C13 and N15-labeled recombinant protein (NP_060832) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells.
• Molecular Mass: 21.7 kDa
• AA Sequence: MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LIN7C lin-7 homolog C, crumbs cell polarity complex component [ Homo sapiens (human) ]
• Official Symbol: LIN7C
• Synonyms: LIN7C; lin-7 homolog C, crumbs cell polarity complex component; MALS3; VELI3; LIN-7C; MALS-3; LIN-7-C; protein lin-7 homolog C; LIN-7 protein 3; mammalian lin-seven protein 3; veli-3; vertebrate lin-7 homolog 3
• Gene ID: 55327
• mRNA Refseq: NM_018362
• Protein Refseq: NP_060832
• MIM: 612332
• UniProt ID: Q9NUP9