Recombinant Human LIMK1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LIMK1-3693H |
Product Overview : | LIMK1 MS Standard C13 and N15-labeled recombinant protein (NP_002305) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. LIMK1 is a serine/threonine kinase that regulates actin polymerization via phosphorylation and inactivation of the actin binding factor cofilin. This protein is ubiquitously expressed during development and plays a role in many cellular processes associated with cytoskeletal structure. This protein also stimulates axon growth and may play a role in brain development. LIMK1 hemizygosity is implicated in the impaired visuospatial constructive cognition of Williams syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Molecular Mass : | 72.4 kDa |
AA Sequence : | MRLTLLCCTWREERMGEEGSELPVCASCGQRIYDGQYLQALNADWHADCFRCCDCSASLSHQYYEKDGQLFCKKDYWARYGESCHGCSEQITKGLVMVAGELKYHPECFICLTCGTFIGDGDTYTLVEHSKLYCGHCYYQTVVTPVIEQILPDSPGSHLPHTVTLVSIPASSHGKRGLSVSIDPPHGPPGCGTEHSHTVRVQGVDPGCMSPDVKNSIHVGDRILEINGTPIRNVPLDEIDLLIQETSRLLQLTLEHDPHDTLGHGLGPETSPLSSPAYTPSGEAGSSARQKPVLRSCSIDRSPGAGSLGSPASQRKDLGRSESLRVVCRPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKVMRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASGMAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRYTVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFLDRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRRGESGLPAHPEVPDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LIMK1 LIM domain kinase 1 [ Homo sapiens (human) ] |
Official Symbol | LIMK1 |
Synonyms | LIMK1; LIM domain kinase 1; LIMK; LIM motif-containing protein kinase; LIMK-1; |
Gene ID | 3984 |
mRNA Refseq | NM_002314 |
Protein Refseq | NP_002305 |
MIM | 601329 |
UniProt ID | P53667 |
◆ Recombinant Proteins | ||
LIMK1-321H | Recombinant Human LIMK1 protein, GST-tagged | +Inquiry |
LIMK1-5707C | Recombinant Chicken LIMK1 | +Inquiry |
Limk1-1320M | Recombinant Mouse Limk1 Protein, MYC/DDK-tagged | +Inquiry |
LIMK1-675HF | Recombinant Full Length Human LIMK1 Protein, GST-tagged | +Inquiry |
LIMK1-1177H | Recombinant Human LIMK1 Protein (R329-G638), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIMK1-4739HCL | Recombinant Human LIMK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LIMK1 Products
Required fields are marked with *
My Review for All LIMK1 Products
Required fields are marked with *
0
Inquiry Basket