Recombinant Human LILRB3 Protein, His-tagged

• Cat.No.: LILRB3-012H
• Product Overview: Recombinant Human LILRB3 Protein with His tag was expressed in E. coli.

Specification

• Description: May act as receptor for class I MHC antigens. Becomes activated upon coligation of LILRB3 and immune receptors, such as FCGR2B and the B-cell receptor. Down-regulates antigen-induced B-cell activation by recruiting phosphatases to its immunoreceptor tyrosine-based inhibitor motifs (ITIM).
• Source: E. coli
• Species: Human
• Tag: His
• Molecular Mass: ~52 kDa
• AA Sequence: GPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLE
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: LILRB3 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 3 [ Homo sapiens (human) ]
• Official Symbol: LILRB3
• Synonyms: LILRB3; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 3; leukocyte immunoglobulin-like receptor subfamily B member 3; CD85a; HL9; ILT5; LIR 3; LIR3; immunoglobulin-like transcript 5; monocyte inhibitory receptor HL9; CD85 antigen-like family member A; leukocyte immunoglobulin-like receptor 3; PIRB; CD85A; ILT-5; LIR-3; MGC138403
• Gene ID: 11025
• mRNA Refseq: NM_001081450
• Protein Refseq: NP_001074919
• MIM: 604820
• UniProt ID: O75022