Recombinant Mouse Lilrb3 protein, His-tagged

• Cat.No.: Lilrb3-5332M
• Product Overview: Recombinant Mouse Lilrb3 protein(P97484)(25-642aa), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Tag: His
• Protein Length: 25-642aa
• Tag: C-His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 70.8 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
  Greater than 90% as determined by SEC-HPLC.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: SLPKPILRVQPDSVVSRRTKVTFLCEETIGANEYRLYKDGKLYKTVTKNKQKPENKAEFSFSNVDLSNAGQYRCSYSTQYKSSGYSDLLELVVTGHYWTPSLLAQASPVVTSGGYVTLQCESWHNDHKFILTVEGPQKLSWTQDSQYNYSTRKYHALFSVGPVTPNQRWICRCYSYDRNRPYVWSPPSESVELLVSGNLQKPTIKAEPGSVITSKRAMTIWCQGNLDAEVYFLHNEKSQKTQSTQTLQEPGNKGKFFIPSVTLQHAGQYRCYCYGSAGWSQPSDTLELVVTGIYEYYEPRLSVLPSPVVTAGGNMTLHCASDFPYDKFILTKEDKKFGNSLDTEHISSSGQYRALFIIGPTTPTHTGAFRCYGYYKNAPQLWSVPSALQQILISGLSKKPSLLTHQGHILDPGMTLTLQCFSDINYDRFALHKVGGADIMQHSSQQTDTGFSVANFTLGYVSSSTGGQYRCYGAHNLSSEWSASSEPLDILITGQLPLTPSLSVQPNHTVHSGETVSLLCWSMDSVDTFILSKEGSAQQPLRLKSKSHDQQSQAEFSMSAVTSHLSGTYRCYGAQDSSFYLLSSASAPVELTVSGPIETSTPPPTMSMPLGGLHMYLK

Gene Information

• Gene Name: Lilrb3 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 3 [ Mus musculus ]
• Official Symbol: Lilrb3
• Synonyms: LILRB3; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 3; leukocyte immunoglobulin-like receptor subfamily B member 3; cell-surface glycoprotein p91; paired immunoglobulin-like receptor B; leukocyte immunoglobulin-like receptor 3; Gp91; Pirb; LIR-3; PIR-B
• Gene ID: 18733
• mRNA Refseq: NM_011095
• Protein Refseq: NP_035225