Recombinant Human LILRB2 protein, His&Myc-tagged

• Cat.No.: LILRB2-5975H
• Product Overview: Recombinant Human LILRB2 protein(Q8N423)(22-460aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: His&Myc
• Protein length: 22-460a.a.
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 55.1 kDa
• AASequence: QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVMAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPGPEDQPLTPTGSDPQSGLGRHLGV
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: LILRB2 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2 [ Homo sapiens ]
• Official Symbol: LILRB2
• Synonyms: LILRB2; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2; leukocyte immunoglobulin-like receptor subfamily B member 2; CD85d; ILT4; LIR 2; LIR2; MIR 10; MIR10; ILT-4; Ig-like transcript 4; immunoglobulin-like transcript 4; CD85 antigen-like family member D; leukocyte immunoglobulin-like receptor 2; monocyte/macrophage immunoglobulin-like receptor 10; leukocyte immunoglobulin-like receptor subfamily B member 2 soluble isoform; eukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6; CD85D; LIR-2; LILRA6; MIR-10
• Gene ID: 10288
• mRNA Refseq: NM_001080978
• Protein Refseq: NP_001074447
• MIM: 604815
• UniProt ID: Q8N423