Recombinant Human LILRB2, His-tagged

• Cat.No.: LILRB2-115H
• Product Overview: Recombinant Human Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 2/LILRB2 produced by transfected human cells is a secreted protein with sequence (Gln22-His458) of Human LILRB2 fused with a polyhistidine tag at the C-terminus.

Specification

• Description: Members of the immunoglobulin-like transcript (ILT) family are activating and inhibitory immunoreceptors whose genes are located same locus that encodes killer cell Ig-like receptors (KIR). Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 2 (LIR-2) is a type I transmembrane protein. LIR-2 is expressed primarily on monocytes and dendritic cells (DC). Human LIR-2 is produced as a 598 amino acino acid precursor including a 21 aa signal sequence, a 440 aa extracellular domain (ECD), a 21 aa transmenbrane segment, and a 116 aa cytoplasmic domain. LIR-2 binds to Classical MHCI proteins. Ligation of LIR-2 incluces Tyr phosphorylation within its cytoplasmic ITIMs, a requirement for association with SHP-1. LIR-2 mediates tolerogenic DC-induced CD4+ T cell energy in vitro and in vivo.
• Source: HEK293
• Species: Human
• Tag: His
• Form: Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
• AA Sequence: QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIP SITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFG GFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLEL LVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANF TLGPVSRSYGGQYRCYGAYNLSSEWSAPSDPLDILITGQIHGTPFISVQPGPTVASGENVTLLCQ SWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPS EPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Protein length: 22-458 a.a.

Gene Information

• Gene Name: LILRB2 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2 [ Homo sapiens ]
• Official Symbol: LILRB2
• Synonyms: LILRB2; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2; leukocyte immunoglobulin-like receptor subfamily B member 2; CD85d; ILT4; LIR 2; LIR2; MIR 10; MIR10; ILT-4; Ig-like transcript 4; immunoglobulin-like transcript 4; CD85 antigen-like family member D; leukocyte immunoglobulin-like receptor 2; monocyte/macrophage immunoglobulin-like receptor 10; leukocyte immunoglobulin-like receptor subfamily B member 2 soluble isoform; eukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6; CD85D; LIR-2; LILRA6; MIR-10
• Gene ID: 10288
• mRNA Refseq: NM_001080978
• Protein Refseq: NP_001074447
• MIM: 604815
• UniProt ID: Q8N423
• Chromosome Location: 19q13.4
• Pathway: Adaptive Immune System, organism-specific biosystem; Immune System, organism-specific biosystem; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell, organism-specific biosystem; Osteoclast differentiation, organism-specific biosystem; Osteoclast differentiation, conserved biosystem
• Function: MHC class I protein binding; MHC class I protein binding; MHC class Ib protein binding; cell adhesion molecule binding; eukaryotic cell surface binding; inhibitory MHC class I receptor activity; inhibitory MHC class I receptor activity; protein binding; protein phosphatase 1 binding; receptor activity