Recombinant Human LILRA5 protein, His-tagged

• Cat.No.: LILRA5-3176H
• Product Overview: Recombinant Human LILRA5 protein(A6NI73)(42-268aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 42-268aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 29.2 kDa
• AA Sequence: GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: LILRA5 leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5 [ Homo sapiens ]
• Official Symbol: LILRA5
• Synonyms: LILRA5; leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 5; LILRB7; leukocyte immunoglobulin-like receptor subfamily A member 5; CD85; CD85f; ILT11; LIR9; leukocyte Ig-like receptor 9; CD85 antigen-like family member F; leukocyte immunoglobulin-like receptor 9; immunoglobulin-like transcript 11 protein; leukocyte immunoglobulin-like receptor subfamily A member 5 soluble; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 7; CD85F; LIR-9; ILT-11
• Gene ID: 353514
• mRNA Refseq: NM_021250
• Protein Refseq: NP_067073
• MIM: 606047
• UniProt ID: A6NI73