Recombinant Human LILRA3 Protein, Fc-tagged
Cat.No. : | LILRA3-352H |
Product Overview : | Recombinant human LILRA3 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 439 |
Description : | This gene encodes a member of a family of immunoreceptors that are expressed predominantly in monocytes and B cells, and at lower levels in dendritic cells and natural killer cells. The encoded protein lacks the transmembrane region found in other members of this family. It acts as a soluble receptor for class I major histocompatibility complex (MHC) antigens. Alternatively spliced transcript variants encoding different isoforms have been found. This gene is located in a cluster of related genes on chromosome 19 and is polymorphic in human populations, with many individuals containing a deletion of this genomic region. |
Form : | Lyophilized |
Molecular Mass : | 71.7 kDa |
AA Sequence : | MTPILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | LILRA3 leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 [ Homo sapiens (human) ] |
Official Symbol | LILRA3 |
Synonyms | LILRA3; leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3; leukocyte immunoglobulin-like receptor subfamily A member 3; CD85e; HM31; HM43; ILT6; LIR 4; LIR4; ILT-6; immunoglobulin-like transcript 6; CD85 antigen-like family member E; leucocyte immunoglobulin-like receptor; monocyte inhibitory receptor HM43/HM31; leukocyte immunoglobulin-like receptor 4; leukocyte immunoglobulin-like receptor A3; e3; CD85E; LIR-4; |
Gene ID | 11026 |
mRNA Refseq | NM_001172654 |
Protein Refseq | NP_001166125 |
MIM | 604818 |
UniProt ID | Q8N6C8 |
◆ Recombinant Proteins | ||
LILRA3-2335R | Recombinant Rhesus Macaque LILRA3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LILRA3-1819R | Recombinant Rhesus Monkey LILRA3 Protein, hIgG1-tagged | +Inquiry |
LILRA3-6698H | Recombinant Human LILRA3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LILRA3-1820R | Recombinant Rhesus Monkey LILRA3 Protein, hIgG4-tagged | +Inquiry |
LILRA3-311HB | Recombinant Human LILRA3 protein, His-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRA3-976HCL | Recombinant Human LILRA3 cell lysate | +Inquiry |
LILRA3-1349HCL | Recombinant Human LILRA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LILRA3 Products
Required fields are marked with *
My Review for All LILRA3 Products
Required fields are marked with *
0
Inquiry Basket