Recombinant Human LILRA3 Protein, Fc-tagged

Cat.No. : LILRA3-352H
Product Overview : Recombinant human LILRA3 protein with Fc tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : Fc
Protein Length : 439
Description : This gene encodes a member of a family of immunoreceptors that are expressed predominantly in monocytes and B cells, and at lower levels in dendritic cells and natural killer cells. The encoded protein lacks the transmembrane region found in other members of this family. It acts as a soluble receptor for class I major histocompatibility complex (MHC) antigens. Alternatively spliced transcript variants encoding different isoforms have been found. This gene is located in a cluster of related genes on chromosome 19 and is polymorphic in human populations, with many individuals containing a deletion of this genomic region.
Form : Lyophilized
Molecular Mass : 71.7 kDa
AA Sequence : MTPILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name LILRA3 leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3 [ Homo sapiens (human) ]
Official Symbol LILRA3
Synonyms LILRA3; leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3; leukocyte immunoglobulin-like receptor subfamily A member 3; CD85e; HM31; HM43; ILT6; LIR 4; LIR4; ILT-6; immunoglobulin-like transcript 6; CD85 antigen-like family member E; leucocyte immunoglobulin-like receptor; monocyte inhibitory receptor HM43/HM31; leukocyte immunoglobulin-like receptor 4; leukocyte immunoglobulin-like receptor A3; e3; CD85E; LIR-4;
Gene ID 11026
mRNA Refseq NM_001172654
Protein Refseq NP_001166125
MIM 604818
UniProt ID Q8N6C8

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LILRA3 Products

Required fields are marked with *

My Review for All LILRA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon