Recombinant Human LIG1, His-tagged
Cat.No. : | LIG1-26930TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 484-919 of Human DNA Ligase I with a N terminal His tag; predicted MWt 50kDa: |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 484-919 a.a. |
Description : | LIG1 encodes DNA ligase I, with functions in DNA replication and the base excision repair process.Mutations in LIG1 that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitution with 96 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEH GLERLPEHCKLSPGIPLKPMLAHPTRGISEVLKRFEEA AFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYP DIISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLT TRKRKEVDASEIQVQVCLYAFDLIYLNGESLVREPLSR RRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSV KDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGV GDTLDLVVIGAYLGRGKRAGRYGGFLLASYDEDSEELQAI CKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVI PDHWLDPSAVWEVKCADLSLSPIYPAARGLVDSDKGIS LRFPRFIRVREDKQPEQATTSAQVACLYRKQSQIQNQQGEDSGSDPEDTY |
Gene Name | LIG1 ligase I, DNA, ATP-dependent [ Homo sapiens ] |
Official Symbol | LIG1 |
Synonyms | LIG1; ligase I, DNA, ATP-dependent; DNA ligase 1; |
Gene ID | 3978 |
mRNA Refseq | NM_000234 |
Protein Refseq | NP_000225 |
MIM | 126391 |
Uniprot ID | P18858 |
Chromosome Location | 19q13.2-q13.3 |
Pathway | Base Excision Repair, organism-specific biosystem; Base excision repair, organism-specific biosystem; Base excision repair, conserved biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; |
Function | ATP binding; DNA binding; DNA ligase (ATP) activity; DNA ligase activity; ligase activity; |
◆ Recombinant Proteins | ||
RFL10670AF | Recombinant Full Length Acinetobacter Sp. Protein Crcb Homolog(Crcb) Protein, His-Tagged | +Inquiry |
HAX1-1860R | Recombinant Rhesus Macaque HAX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SYK-5859R | Recombinant Rat SYK Protein | +Inquiry |
DKK3-070H | Recombinant Human DKK3 Protein, Pro23-Ile350, C-His-Avi tagged, Biotinylated | +Inquiry |
Fzr1-3120M | Recombinant Mouse Fzr1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
ALB-316B | Native Bovine Albumin Protein, Biotinylated | +Inquiry |
Lectin-1798L | Active Native Lotus Tetragonolobus Lectin Protein, Fluorescein labeled | +Inquiry |
FABP3-42H | Native Human FABP3 | +Inquiry |
Hyaluronidase-39O | Active Native Ovine Hyaluronidase | +Inquiry |
CGB-1856H | Native Human Chorionic Gonadotropin, Beta Polypeptide | +Inquiry |
◆ Cell & Tissue Lysates | ||
AOC2-8822HCL | Recombinant Human AOC2 293 Cell Lysate | +Inquiry |
PES1-1334HCL | Recombinant Human PES1 cell lysate | +Inquiry |
TIGIT-1420MCL | Recombinant Mouse TIGIT cell lysate | +Inquiry |
GBA3-661HCL | Recombinant Human GBA3 cell lysate | +Inquiry |
C12orf5-8316HCL | Recombinant Human C12orf5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LIG1 Products
Required fields are marked with *
My Review for All LIG1 Products
Required fields are marked with *
0
Inquiry Basket