Active Recombinant Full Length Human LIG1 Protein, C-Flag-tagged
Cat.No. : | LIG1-196HFL |
Product Overview : | Recombinant Full Length Human LIG1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the ATP-dependent DNA ligase protein family. The encoded protein functions in DNA replication, recombination, and the base excision repair process. Mutations in this gene that lead to DNA ligase I deficiency result in immunodeficiency and increased sensitivity to DNA-damaging agents. Disruption of this gene may also be associated with a variety of cancers. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme activity |
Molecular Mass : | 101.6 kDa |
AA Sequence : | MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKAARVLGSEGEE EDEALSPAKGQKPALDCSQVSPPRPATSPENNASLSDTSPMDSSPSGIPKRRTARKQLPKRTIQEVLEEQ SEDEDREAKRKKEEEEEETPKESLTEAEVATEKEGEDGDQPTTPPKPLKTSKAETPTESVSEPEVATKQE LQEEEEQTKPPRRAPKTLSSFFTPRKPAVKKEVKEEEPGAPGKEGAAEGPLDPSGYNPAKNNYHPVEDAC WKPGQKVPYLAVARTFEKIEEVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVG DGVLLKAVAQATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIARLTGSAST AKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAMVDAGKGKTAE ARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPLKPMLAHPTRGISEVLKRFEE AAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDREKK QIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLD TKDIEQIAEFLEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGK RAGRYGGFLLASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSA VWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQSQIQNQQGED SGSDPEDTYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Base excision repair, DNA replication, Mismatch repair, Nucleotide excision repair |
Full Length : | Full L. |
Gene Name | LIG1 DNA ligase 1 [ Homo sapiens (human) ] |
Official Symbol | LIG1 |
Synonyms | LIGI; IMD96; hLig1 |
Gene ID | 3978 |
mRNA Refseq | NM_000234.3 |
Protein Refseq | NP_000225.1 |
MIM | 126391 |
UniProt ID | P18858 |
◆ Recombinant Proteins | ||
Arl5a-1708M | Recombinant Mouse Arl5a Protein, Myc/DDK-tagged | +Inquiry |
NR2F2-6187M | Recombinant Mouse NR2F2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ZBTB6-18729M | Recombinant Mouse ZBTB6 Protein | +Inquiry |
GNGT1-7042M | Recombinant Mouse GNGT1 Protein | +Inquiry |
BST1-5121H | Recombinant Human BST1 Protein (Met1-Lys292), C-His tagged | +Inquiry |
◆ Native Proteins | ||
MLC-240H | Native Human Myosin Light Chain | +Inquiry |
Cysteine-01C | Native Clostridium histolyticum Cysteine (C41, heavy chain) | +Inquiry |
MMP2-29475TH | Native Human MMP2 | +Inquiry |
FTL-673H | Native Human Ferritin, Light Polypeptide | +Inquiry |
Collagen Type I-03R | Native Rat Collagen Type I (Atelocollagen) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
INHA-5204HCL | Recombinant Human INHA 293 Cell Lysate | +Inquiry |
C14orf119-8290HCL | Recombinant Human C14orf119 293 Cell Lysate | +Inquiry |
USP4-456HCL | Recombinant Human USP4 293 Cell Lysate | +Inquiry |
TMED10-670HCL | Recombinant Human TMED10 lysate | +Inquiry |
PRKAG2-2864HCL | Recombinant Human PRKAG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LIG1 Products
Required fields are marked with *
My Review for All LIG1 Products
Required fields are marked with *
0
Inquiry Basket