Recombinant Human LIF Protein, His-tagged

• Cat.No.: LIF-11H
• Product Overview: Recombinant Human LIF Protein with His tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Description: The protein encoded by this gene is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Form: Liquid
• AA Sequence: SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAFGGGGSHHHHHH*
• Purity: > 90% determined by SDS-PAGE (Reduced)
• Storage: Store at -20 to -80 centigrade.
• Storage Buffer: PBS, pH 6.8

Gene Information

• Gene Name: LIF LIF interleukin 6 family cytokine [ Homo sapiens (human) ]
• Official Symbol: LIF
• Synonyms: LIF; LIF interleukin 6 family cytokine; CDF; DIA; HILDA; MLPLI; leukemia inhibitory factor; D factor; cholinergic differentiation factor; differentiation inhibitory activity; differentiation-inducing factor; differentiation-stimulating factor; hepatocyte-stimulating factor III; human interleukin in DA cells; melanoma-derived LPL inhibitor
• Gene ID: 3976
• mRNA Refseq: NM_002309
• Protein Refseq: NP_002300
• MIM: 159540
• UniProt ID: P15018