Recombinant Human LGI1 protein, His-PDI-tagged

• Cat.No.: LGI1-5363H
• Product Overview: Recombinant Human LGI1 protein(O95970)(35-557aa), fused with N-terminal His and PDI tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: N-His-PDI
• ProteinLength: 35-557aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 118.9 kDa
• AASequence: KKPAKPKCPAVCTCTKDNALCENARSIPRTVPPDVISLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYLFIENNNIKSISRHTFRGLKSLIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVAQLFGGSHIYKRDSFANKFIKIQDIEILKIRKPNDIETFKIENNWYFVVADSSKAGFTTIYKWNGNGFYSHQSLHAWYRDTDVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQLFTNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQPLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: LGI1 leucine-rich, glioma inactivated 1 [ Homo sapiens ]
• Official Symbol: LGI1
• Synonyms: LGI1; leucine-rich, glioma inactivated 1; epilepsy, partial , EPT; leucine-rich glioma-inactivated protein 1; EPITEMPIN; ETL1; IB1099; epitempin-1; EPT; ADLTE; ADPAEF
• Gene ID: 9211
• mRNA Refseq: NM_005097
• Protein Refseq: NP_005088
• MIM: 604619
• UniProt ID: O95970