Recombinant Human LGALS9 protein, His-GST-tagged

• Cat.No.: LGALS9-3170H
• Product Overview: Recombinant Human LGALS9 protein(O00182)(1-323aa), fused to N-terminal His tag and GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His
• Protein Length: 1-323aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 65.9 kDa
• AA Sequence: MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: LGALS9 lectin, galactoside-binding, soluble, 9 [ Homo sapiens ]
• Official Symbol: LGALS9
• Synonyms: LGALS9; lectin, galactoside-binding, soluble, 9; galectin-9; galectin 9; LGALS9A; gal-9; ecalectin; tumor antigen HOM-HD-21; urate transporter/channel protein; HUAT; MGC117375; MGC125973; MGC125974
• Gene ID: 3965
• mRNA Refseq: NM_002308
• Protein Refseq: NP_002299
• MIM: 601879
• UniProt ID: O00182