Recombinant Human LGALS9 Protein

• Cat.No.: LGALS9-660H
• Product Overview: Recombinant human LGALS9 protein without tag was expressed in HEK293.

Specification

• Description: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene.
• Source: HEK293
• Species: Human
• Form: Lyophilized
• Molecular Mass: 36.6 kDa
• Protein length: 355
• AA Sequence: MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: LGALS9 lectin, galactoside-binding, soluble, 9 [ Homo sapiens (human) ]
• Official Symbol: LGALS9
• Synonyms: LGALS9; lectin, galactoside-binding, soluble, 9; galectin-9; galectin 9; LGALS9A; gal-9; ecalectin; tumor antigen HOM-HD-21; urate transporter/channel protein; HUAT; MGC117375; MGC125973; MGC125974
• Gene ID: 3965
• mRNA Refseq: NM_002308
• Protein Refseq: NP_002299
• MIM: 601879
• UniProt ID: O00182