Recombinant Human LGALS9 Protein
Cat.No. : | LGALS9-660H |
Product Overview : | Recombinant human LGALS9 protein without tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Protein Length : | 355 |
Description : | The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene. |
Form : | Lyophilized |
Molecular Mass : | 36.6 kDa |
AA Sequence : | MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | LGALS9 lectin, galactoside-binding, soluble, 9 [ Homo sapiens (human) ] |
Official Symbol | LGALS9 |
Synonyms | LGALS9; lectin, galactoside-binding, soluble, 9; galectin-9; galectin 9; LGALS9A; gal-9; ecalectin; tumor antigen HOM-HD-21; urate transporter/channel protein; HUAT; MGC117375; MGC125973; MGC125974; |
Gene ID | 3965 |
mRNA Refseq | NM_002308 |
Protein Refseq | NP_002299 |
MIM | 601879 |
UniProt ID | O00182 |
◆ Recombinant Proteins | ||
LGALS9-471HAF555 | Recombinant Human LGALS9 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
LGALS9-195H | Active Recombinant Human LGALS9 Protein (Ala2-Thr355), N-His tagged, Animal-free, Carrier-free | +Inquiry |
Lgals9-436R | Recombinant Rat Lgals9 Protein, His-tagged | +Inquiry |
LGALS9-2391D | Recombinant Dog LGALS9 Protein, His-tagged | +Inquiry |
Lgals9-435R | Recombinant Rat Lgals9 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGALS9-4761HCL | Recombinant Human LGALS9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LGALS9 Products
Required fields are marked with *
My Review for All LGALS9 Products
Required fields are marked with *
0
Inquiry Basket