Recombinant Human LGALS8 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LGALS8-849H
• Product Overview: LGALS8 MS Standard C13 and N15-labeled recombinant protein (NP_963838) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 35.7 kDa
• AA Sequence: MLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LGALS8 galectin 8 [ Homo sapiens (human) ]
• Official Symbol: LGALS8
• Synonyms: LGALS8; lectin, galactoside-binding, soluble, 8; galectin-8; galectin 8; PCTA 1; galectin-8g; Po66 carbohydrate binding protein; po66 carbohydrate-binding protein; prostate carcinoma tumor antigen 1; Gal-8; PCTA1; PCTA-1; Po66-CBP
• Gene ID: 3964
• mRNA Refseq: NM_201544
• Protein Refseq: NP_963838
• MIM: 606099
• UniProt ID: O00214