Recombinant Human LGALS3 protein
Cat.No. : | LGALS3-4952H |
Product Overview : | Recombinant Human LGALS3 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 249 |
Description : | Human Galectin-3 also named AGE-R3, CBP35, GAL3, L29, LGALS3, Mac-2, is belonging to the galectins family and it is encoded by a single gene, LGALS3, located on chromosome 14, locus q21–q22. It is expressed in the nucleus, cytoplasm, mitochondrion, cell surface, and extracellular space. Galectin-3 is approximately 30 kDa and, like all galectins, contains a carbohydrate-recognition-binding domain (CRD) of about 130 amino acids that enable the specific binding of β-galactosides. Given Galectin-3’s broad biological functionality, it has been demonstrated to be involved in cancer, inflammation and fibrosis, heart disease, and stroke. Studies have also shown that the expression of galectin-3 is implicated in a variety of processes associated with heart failure, including myofibroblast proliferation, fibrogenesis, tissue repair, inflammation, and Ventricular remodeling. Human Galectin-3 shares 79% amino acid sequence identity with rat and mouse Galectin-3, respectively. |
Form : | Lyophilized from a 0.2μm filtered solution in 1 × PBS, pH 7.4, 3mM DTT. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by its ability to agglutinate human red blood cells is less than 10 μg/ml. |
Molecular Mass : | Approximately 26.0 kDa, a single non-glycosylated polypeptide chain containing 249 amino acids. |
AA Sequence : | ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI |
Endotoxin : | Less than 0.1 EU/µg of rHuGalectin-3 as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | LGALS3 |
Official Symbol | LGALS3 |
Synonyms | LGALS3; lectin, galactoside-binding, soluble, 3; LGALS2; galectin-3; galectin 3; GALIG; MAC 2; lectin L-29; 35 kDa lectin; MAC-2 antigen; IgE-binding protein; laminin-binding protein; galactose-specific lectin 3; carbohydrate-binding protein 35; L31; GAL3; MAC2; CBP35; GALBP; |
Gene ID | 3958 |
mRNA Refseq | NM_001177388 |
Protein Refseq | NP_001170859 |
MIM | 153619 |
UniProt ID | P17931 |
◆ Recombinant Proteins | ||
LGALS3-408H | Recombinant Human LGALS3 Protein, His-tagged | +Inquiry |
Lgals3-7258M | Active Recombinant Mouse Lgals3 Protein, His-tagged | +Inquiry |
LGALS3-6977H | Recombinant Human LGALS3 protein(Met1-Ile250) | +Inquiry |
LGALS3-452H | Active Recombinant Human Lectin, Galactoside-Binding, Soluble, 3 | +Inquiry |
LGALS3-2858H | Recombinant Human LGALS3 Protein (Ala2-Ile250), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGALS3-4766HCL | Recombinant Human LGALS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LGALS3 Products
Required fields are marked with *
My Review for All LGALS3 Products
Required fields are marked with *
0
Inquiry Basket