Recombinant Human LGALS3 protein

• Cat.No.: LGALS3-4952H
• Product Overview: Recombinant Human LGALS3 protein was expressed in Escherichia coli.

Specification

• Description: Human Galectin-3 also named AGE-R3, CBP35, GAL3, L29, LGALS3, Mac-2, is belonging to the galectins family and it is encoded by a single gene, LGALS3, located on chromosome 14, locus q21–q22. It is expressed in the nucleus, cytoplasm, mitochondrion, cell surface, and extracellular space. Galectin-3 is approximately 30 kDa and, like all galectins, contains a carbohydrate-recognition-binding domain (CRD) of about 130 amino acids that enable the specific binding of β-galactosides. Given Galectin-3’s broad biological functionality, it has been demonstrated to be involved in cancer, inflammation and fibrosis, heart disease, and stroke. Studies have also shown that the expression of galectin-3 is implicated in a variety of processes associated with heart failure, including myofibroblast proliferation, fibrogenesis, tissue repair, inflammation, and Ventricular remodeling. Human Galectin-3 shares 79% amino acid sequence identity with rat and mouse Galectin-3, respectively.
• Source: E.coli
• Species: Human
• Form: Lyophilized from a 0.2μm filtered solution in 1 × PBS, pH 7.4, 3mM DTT.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by its ability to agglutinate human red blood cells is less than 10 μg/ml.
• Molecular Mass: Approximately 26.0 kDa, a single non-glycosylated polypeptide chain containing 249 amino acids.
• Protein length: 249
• AA Sequence: ADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
• Endotoxin: Less than 0.1 EU/µg of rHuGalectin-3 as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Tag: Non

Gene Information

• Gene Name: LGALS3
• Official Symbol: LGALS3
• Synonyms: LGALS3; lectin, galactoside-binding, soluble, 3; LGALS2; galectin-3; galectin 3; GALIG; MAC 2; lectin L-29; 35 kDa lectin; MAC-2 antigen; IgE-binding protein; laminin-binding protein; galactose-specific lectin 3; carbohydrate-binding protein 35; L31; GAL3; MAC2; CBP35; GALBP
• Gene ID: 3958
• mRNA Refseq: NM_001177388
• Protein Refseq: NP_001170859
• MIM: 153619
• UniProt ID: P17931