Recombinant Human LELP1 protein, GST-tagged
Cat.No. : | LELP1-4515H |
Product Overview : | Recombinant Human LELP1 protein(Q5T871)(1-98aa), fused to N-terminal GST tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-98aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 37.7 kDa |
AA Sequence : | MSSDDKSKSNDPKTEPKNCDPKCEQKCESKCQPSCLKKLLQRCFEKCPWEKCPAPPKCLPCPSQSPSSCPPQPCTKPCPPKCPSSCPHACPPPCPPPE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | LELP1 late cornified envelope-like proline-rich 1 [ Homo sapiens ] |
Official Symbol | LELP1 |
Gene ID | 149018 |
mRNA Refseq | NM_001010857.1 |
Protein Refseq | NP_001010857.1 |
MIM | 611042 |
UniProt ID | Q5T871 |
◆ Recombinant Proteins | ||
LELP1-418H | Recombinant Human LELP1 Protein, His-tagged | +Inquiry |
LELP1-4515H | Recombinant Human LELP1 protein, GST-tagged | +Inquiry |
LELP1-397C | Recombinant Cynomolgus Monkey LELP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LELP1-651C | Recombinant Cynomolgus LELP1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LELP1-4777HCL | Recombinant Human LELP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LELP1 Products
Required fields are marked with *
My Review for All LELP1 Products
Required fields are marked with *
0
Inquiry Basket