Recombinant Human LEFTY1 Protein, Fc-tagged

• Cat.No.: LEFTY1-003H
• Product Overview: Recombinant Human LEFTY1 Protein with Fc tag was expressed in HEK293.

Specification

• Description: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in left-right asymmetry determination of organ systems during development. This gene is closely linked to both a related family member and a related pseudogene.
• Source: HEK293
• Species: Human
• Tag: Fc
• Molecular Mass: 59 kDa
• AA Sequence: RFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQPDDDDKEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 70 % by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.34 mg/mL
• Storage Buffer: PBS, pH 7.4

Gene Information

• Gene Name: LEFTY1 left-right determination factor 1 [ Homo sapiens (human) ]
• Official Symbol: LEFTY1
• Synonyms: LEFTY1; left-right determination factor 1; LEFTB; LEFTYB; left-right determination factor 1; left-right determination factor B; protein lefty-1; protein lefty-B
• Gene ID: 10637
• mRNA Refseq: NM_020997
• Protein Refseq: NP_066277
• MIM: 603037
• UniProt ID: O75610