Recombinant Cynomolgus Monkey LEFTY1 Protein, His-Tagged

• Cat.No.: LEFTY-001C
• Product Overview: Recombinant Cynomolgus Monkey LEFTY1 Protein, His-Tagged was expressed in HEK293 cell

Specification

• Species: Cynomolgus
• Source: HEK293
• Tag: His
• Description: Lefty (left-right determination factors) are a class of proteins that are closely related members of the TGF-beta superfamily of growth factors. These proteins are secreted and play a role in left-right asymmetry determination of organ systems during development.[1] Mutations of the genes encoding these proteins have been associated with left-right axis malformations, particularly in the heart and lungs.
• Molecular Mass: The protein has a calculated MW of 39.7 kDa.
• AA Sequence: LTGEQLLGSLLQQLQLSEAPVLDRADMEELVIPAHVRAQYVTLLQRSHGDRSRGKRFSQSFREVAGRFLASEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKATLHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKVFDVTEAVNFWQQLSRPRQPLLLQVSVQREHPGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPVTEGTRCCRQEMYIDLQGMKWADNWVLEPPGFLAYECVGTCQQPPEALAFKWPFLGPRQCIASETASLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRGLQPDDDDKHHHHHH
• Endotoxin: ＜1EU/ug by LAL
• Purity: ＞90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1.25 mg/ml
• Storage Buffer: 25mM Tris, 150mM NaCl, pH 8.0.