Recombinant Human LECT2 protein, GST-tagged

Cat.No. : LECT2-9032H
Product Overview : Recombinant Human LECT2(1 a.a. - 151 a.a.) fused with GST tag at N-terminal was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1 a.a. - 151 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
AA Sequence : MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDVLCSAGSTVYAPFTGMIV GQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAY L
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name LECT2 leukocyte cell-derived chemotaxin 2 [ Homo sapiens ]
Official Symbol LECT2
Synonyms LECT2; leukocyte cell-derived chemotaxin 2; leukocyte cell-derived chemotaxin-2; chm II; chm2; chondromodulin-II; chm-II; MGC126628;
Gene ID 3950
mRNA Refseq NM_002302
Protein Refseq NP_002293
MIM 602882
UniProt ID O14960
Chromosome Location 5q31.1
Pathway C-MYB transcription factor network, organism-specific biosystem;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LECT2 Products

Required fields are marked with *

My Review for All LECT2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon