Recombinant Human LDHB, His-tagged

• Cat.No.: LDHB-26865TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-334 of Human lactate dehydrogenase B with N terminal His tag; 354 amino acids, 36.6kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 334 amino acids
• Description: This gene encodes an enzyme which catalyzes the reversible conversion of lactate and pyruvate, and NAD and NADH, in the glycolytic pathway. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on the X chromosome and on chromosome. Multiple alternatively spliced variants, encoding the same protein, have been identified.
• Conjugation: HIS
• Molecular Weight: 36.600kDa inclusive of tags
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0
• Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHH SSGLVPRGSHMATLKEKLIAPVAEEEATVP NNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL
• Sequence Similarities: Belongs to the LDH/MDH superfamily. LDH family.

Gene Information

• Gene Name: LDHB lactate dehydrogenase B [ Homo sapiens ]
• Official Symbol: LDHB
• Synonyms: LDHB; lactate dehydrogenase B; L-lactate dehydrogenase B chain
• Gene ID: 3945
• mRNA Refseq: NM_001174097
• Protein Refseq: NP_001167568
• MIM: 150100
• Uniprot ID: P07195
• Chromosome Location: 12p12.2-p12.1
• Pathway: Cysteine and methionine metabolism, organism-specific biosystem; Cysteine and methionine metabolism, conserved biosystem; Glycolysis / Gluconeogenesis, organism-specific biosystem; Glycolysis / Gluconeogenesis, conserved biosystem; Glycolysis and Gluconeogenesis, organism-specific biosystem
• Function: L-lactate dehydrogenase activity; NAD binding; identical protein binding; oxidoreductase activity