Recombinant Human LDHA protein, GST-tagged

• Cat.No.: LDHA-30120H
• Product Overview: Recombinant Human LDHA (283-332 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Ile283-Phe332
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: IKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: LDHA lactate dehydrogenase A [ Homo sapiens ]
• Official Symbol: LDHA
• Synonyms: LDHA; lactate dehydrogenase A; L-lactate dehydrogenase A chain; LDH-A; LDH-M; LDH muscle subunit; lactate dehydrogenase M; proliferation-inducing gene 19; renal carcinoma antigen NY-REN-59; cell proliferation-inducing gene 19 protein; LDH1; LDHM; GSD11; PIG19
• Gene ID: 3939
• mRNA Refseq: NM_001135239
• Protein Refseq: NP_001128711
• MIM: 150000
• UniProt ID: P00338