Recombinant Human LDHA, GST-tagged

Description :	The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene.
Source :	Wheat germ
Species :	Human
Tag :	GST
Molecular Mass :	63.1 kDa
AA Sequence :	MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTP KIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKI SGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKE QWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI SDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Applications :	ELISA; WB-Re; AP; Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	LDHA lactate dehydrogenase A [ Homo sapiens (human) ]
Official Symbol	LDHA
Synonyms	LDHA; lactate dehydrogenase A; LDH1; LDHM; GSD11; PIG19; L-lactate dehydrogenase A chain; LDH-A; LDH-M; LDH muscle subunit; lactate dehydrogenase M; proliferation-inducing gene 19; renal carcinoma antigen NY-REN-59; cell proliferation-inducing gene 19 protein; EC 1.1.1.27
Gene ID	3939
mRNA Refseq	NM_005566
Protein Refseq	NP_005557
MIM	150000
UniProt ID	P00338
Chromosome Location	11p15.4
Pathway	Central carbon metabolism in cancer; Cysteine and methionine metabolism; Glycolysis / Gluconeogenesis
Function	L-lactate dehydrogenase activity; protein binding