Recombinant Human LCP2

• Cat.No.: LCP2-30444TH
• Product Overview: Recombinant full length Human SLP76 with N terminal proprietary tag, predicted mwt: 84.74kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 533 amino acids
• Description: SLP-76 was originally identified as a substrate of the ZAP-70 protein tyrosine kinase following T cell receptor (TCR) ligation in the leukemic T cell line Jurkat. The SLP-76 locus has been localized to human chromosome 5q33 and the gene structure has been partially characterized in mice. The human and murine cDNAs both encode 533 amino acid proteins that are 72% identical and comprised of three modular domains. The NH2-terminus contains an acidic region that includes a PEST domain and several tyrosine residues which are phosphorylated following TCR ligation. SLP-76 also contains a central proline-rich domain and a COOH-terminal SH2 domain. A number of additional proteins have been identified that associate with SLP-76 both constitutively and inducibly following receptor ligation, supporting the notion that SLP-76 functions as an adaptor or scaffold protein. Studies using SLP-76 deficient T cell lines or mice have provided strong evidence that SLP-76 plays a positive role in promoting T cell development and activation as well as mast cell and platelet function.
• Molecular Weight: 84.740kDa inclusive of tags
• Tissue specificity: Highly expressed in spleen, thymus and peripheral blood leukocytes. Highly expressed also in T-cell and monocytic cell lines, expressed at lower level in B-cell lines. Not detected in fibroblast or neuroblastoma cell lines.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYH IDGARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRS IFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQ DGEDDGDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSI LPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPP PAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTK PPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRSLGEHLP KIQKPPLPPTTERHERSSPLPGKKPPVPKHGWGPDRREND EDDVHQRPLPQPALLPMSSNTFPSRSTKPSPMNPLPSSHM PGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPL PLPNKPRPPSPAEEENSLNEEWYVSYITRPEAEAALRKIN QDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKES QVYLLGTGLRGKEDFLSVSDIIDYFRKMPLLLIDGKNRGS RYQCTLTHAAGYP
• Sequence Similarities: Contains 1 SAM (sterile alpha motif) domain.Contains 1 SH2 domain.

Gene Information

• Gene Name: LCP2 lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa) [ Homo sapiens ]
• Official Symbol: LCP2
• Synonyms: LCP2; lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa); lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kD) , SLP76; lymphocyte cytosolic protein 2; 76 kDa tyrosine phosphoprotein; SH2 domain c
• Gene ID: 3937
• mRNA Refseq: NM_005565
• Protein Refseq: NP_005556
• MIM: 601603
• Uniprot ID: Q13094
• Chromosome Location: 5q33.1-qter
• Pathway: Adaptive Immune System, organism-specific biosystem; B Cell Receptor Signaling Pathway, organism-specific biosystem; Fc epsilon RI signaling pathway, organism-specific biosystem; Fc epsilon RI signaling pathway, conserved biosystem; Fc-epsilon receptor I signaling in mast cells, organism-specific biosystem