Recombinant Human LCP2 Protein, His-tagged

Cat.No. : LCP2-299H
Product Overview : Recombinant Human LCP2 fused with His tag at C-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Involved in T-cell antigen receptor mediated signaling.
Form : Supplied as a 0.2 µM filtered solution of 20mM Tris, 150mM NaCl, 20%glycerol, pH8.5
Molecular Mass : 62.6kD
AA Sequence : MASMTGGQQMGRGSMALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKLRVPILSKLSQEINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGEDDGDYESPNEEEEAPVEDDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPPPAGRNHSPLPPPQTNHEEPSRSRNHKTAKLPAPSIDRSTKP
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name LCP2 lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa) [ Homo sapiens ]
Official Symbol LCP2
Synonyms LCP2; lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kDa); lymphocyte cytosolic protein 2 (SH2 domain containing leukocyte protein of 76kD) , SLP76; lymphocyte cytosolic protein 2; 76 kDa tyrosine phosphoprotein; SH2 domain containing leukocyte protein of 76kD; SLP 76; SLP-76 tyrosine phosphoprotein; SH2 domain-containing leukocyte protein of 76kD; SH2 domain-containing leukocyte protein of 76 kDa; SLP76; SLP-76;
Gene ID 3937
mRNA Refseq NM_005565
Protein Refseq NP_005556
MIM 601603
UniProt ID Q13094

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LCP2 Products

Required fields are marked with *

My Review for All LCP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon