Recombinant Human LCOR Protein, GST-tagged

• Cat.No.: LCOR-5396H
• Product Overview: Human MLR2 partial ORF ( NP_115816.1, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: LCOR is a transcriptional corepressor widely expressed in fetal and adult tissues that is recruited to agonist-bound nuclear receptors through a single LxxLL motif, also referred to as a nuclear receptor (NR) box (Fernandes et al., 2003 [PubMed 12535528]).[supplied by OMIM
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: MQRMIQQFAAEYTSKNSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMADQDSPLDLTVRKSQSEPSEQDGVLDLSTKKSPCAGSTSLSH
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LCOR ligand dependent nuclear receptor corepressor [ Homo sapiens ]
• Official Symbol: LCOR
• Synonyms: LCOR; ligand dependent nuclear receptor corepressor; ligand-dependent corepressor; FLJ38026; KIAA1795; MLR2; mblk1-related protein 2; RP11-175O19.1
• Gene ID: 84458
• mRNA Refseq: NM_001170765
• Protein Refseq: NP_001164236
• MIM: 607698
• UniProt ID: Q96JN0