Recombinant Human LCOR Protein, GST-tagged
Cat.No. : | LCOR-5396H |
Product Overview : | Human MLR2 partial ORF ( NP_115816.1, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | LCOR is a transcriptional corepressor widely expressed in fetal and adult tissues that is recruited to agonist-bound nuclear receptors through a single LxxLL motif, also referred to as a nuclear receptor (NR) box (Fernandes et al., 2003 [PubMed 12535528]).[supplied by OMIM |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MQRMIQQFAAEYTSKNSSTQDPSQPNSTKNQSLPKASPVTTSPTAATTQNPVLSKLLMADQDSPLDLTVRKSQSEPSEQDGVLDLSTKKSPCAGSTSLSH |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LCOR ligand dependent nuclear receptor corepressor [ Homo sapiens ] |
Official Symbol | LCOR |
Synonyms | LCOR; ligand dependent nuclear receptor corepressor; ligand-dependent corepressor; FLJ38026; KIAA1795; MLR2; mblk1-related protein 2; RP11-175O19.1; |
Gene ID | 84458 |
mRNA Refseq | NM_001170765 |
Protein Refseq | NP_001164236 |
MIM | 607698 |
UniProt ID | Q96JN0 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All LCOR Products
Required fields are marked with *
My Review for All LCOR Products
Required fields are marked with *
0
Inquiry Basket