Recombinant Human LCN2 protein

Cat.No. : LCN2-28594TH
Product Overview : Recombinant Human LCN2 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a protein that belongs to the lipocalin family. Members of this family transport small hydrophobic molecules such as lipids, steroid hormones and retinoids. The protein encoded by this gene is a neutrophil gelatinase-associated lipocalin and plays a role in innate immunity by limiting bacterial growth as a result of sequestering iron-containing siderophores. The presence of this protein in blood and urine is an early biomarker of acute kidney injury. This protein is thought to be be involved in multiple cellular processes, including maintenance of skin homeostasis, and suppression of invasiveness and metastasis. Mice lacking this gene are more susceptible to bacterial infection than wild type mice.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 0.05 % Tween-20.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human TF-1 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg.
Molecular Mass : Approximately 41.0 kDa, a homodimeric protein consisting of two 178 amino acid non-glycosylated polypeptide chains.
Protein length : 178
AA Sequence : QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG
Endotoxin : Less than 0.1 EU/μg of rHuLCN2 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Tag : Non
Gene Name LCN2
Official Symbol LCN2
Synonyms LCN2; lipocalin 2; lipocalin 2 (oncogene 24p3); neutrophil gelatinase-associated lipocalin; 24p3; neutrophil gelatinase associated lipocalin; NGAL; oncogene 24p3; siderocalin; p25; lipocalin-2; migration-stimulating factor inhibitor; 25 kDa alpha-2-microglobulin-related subunit of MMP-9; MSFI;
Gene ID 3934
mRNA Refseq NM_005564
Protein Refseq NP_005555
MIM 600181
UniProt ID P80188

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LCN2 Products

Required fields are marked with *

My Review for All LCN2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon