Recombinant Human LCE3C Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LCE3C-946H
• Product Overview: LCE3C MS Standard C13 and N15-labeled recombinant protein (NP_848521) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Precursors of the cornified envelope of the stratum corneum.
• Molecular Mass: 9.7 kDa
• AA Sequence: MSCQQNQQQCQPPPSCPSPKCPPKSPAQCLPPPSSDCALSSGGCGPSSESGCCLSHHRHFRSHQCRRQRSNSCDRGSGQQGGGSCRGHGSGGCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LCE3C late cornified envelope 3C [ Homo sapiens (human) ]
• Official Symbol: LCE3C
• Synonyms: LCE3C; late cornified envelope 3C; LEP15; SPRL3A; late cornified envelope protein 3C; late envelope protein 15; small proline rich-like (epidermal differentiation complex) 3A; small proline-rich-like epidermal differentiation complex protein 3A
• Gene ID: 353144
• mRNA Refseq: NM_178434
• Protein Refseq: NP_848521
• MIM: 612615
• UniProt ID: Q5T5A8