Recombinant Human LCE3B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LCE3B-2924H
Product Overview : LCE3B MS Standard C13 and N15-labeled recombinant protein (NP_848520) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Precursors of the cornified envelope of the stratum corneum.
Molecular Mass : 9.6 kDa
AA Sequence : MSCQQNQQQCQPLPKCPSPKCPPKSSAQCLPPASSCCAPRPGCCGGPSSEGGCCLSHHRCCRSHRCRRQSSNSCDRGSGQQDGASDCGYGSGGCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LCE3B late cornified envelope 3B [ Homo sapiens (human) ]
Official Symbol LCE3B
Synonyms LCE3B; late cornified envelope 3B; LEP14; late cornified envelope protein 3B; late envelope protein 14
Gene ID 353143
mRNA Refseq NM_178433
Protein Refseq NP_848520
MIM 612614
UniProt ID Q5TA77

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LCE3B Products

Required fields are marked with *

My Review for All LCE3B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon