Recombinant Human LCE3A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LCE3A-553H
• Product Overview: LCE3A MS Standard C13 and N15-labeled recombinant protein (NP_848518) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: Precursors of the cornified envelope of the stratum corneum.
• Molecular Mass: 9 kDa
• AA Sequence: MSCQQNQQQCQPPPKCPAKSPAQCLPPASSSCAPSSGGCGPSSERSCCLSHHRCRRSHRCRCQSSNSCDRGSGQQGGSSSCGHSSAGCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LCE3A late cornified envelope 3A [ Homo sapiens (human) ]
• Official Symbol: LCE3A
• Synonyms: LCE3A; late cornified envelope 3A; LEP13; late cornified envelope protein 3A; late envelope protein 13
• Gene ID: 353142
• mRNA Refseq: NM_178431
• Protein Refseq: NP_848518
• MIM: 612613
• UniProt ID: Q5TA76