Recombinant Human LCE2B protein, His-tagged

Cat.No. : LCE2B-2617H
Product Overview : Recombinant Human LCE2B protein(1-70 aa), fused to His tag, was expressed in E. coli.
Availability April 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-70 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCLPQCPAPCSPAVSSCCGPISGGCCGPSSGGCCNSGAGG
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name LCE2B late cornified envelope 2B [ Homo sapiens ]
Official Symbol LCE2B
Synonyms LCE2B; late cornified envelope 2B; small proline rich like (epidermal differentiation complex) 1B , SPRL1B; late cornified envelope protein 2B; LEP10; XP5; late envelope protein 10; skin-specific protein Xp5; small proline rich-like (epidermal differentiation complex) 1B; small proline-rich-like epidermal differentiation complex protein 1B; SPRL1B;
Gene ID 26239
mRNA Refseq NM_014357
Protein Refseq NP_055172
MIM 612610
UniProt ID O14633

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LCE2B Products

Required fields are marked with *

My Review for All LCE2B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon