Recombinant Human LBX1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LBX1-3351H
• Product Overview: LBX1 MS Standard C13 and N15-labeled recombinant protein (NP_006553) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: This gene and the orthologous mouse gene were found by their homology to the Drosophila lady bird early and late homeobox genes. In the mouse, this gene is a key regulator of muscle precursor cell migration and is required for the acquisition of dorsal identities of forelimb muscles.
• Molecular Mass: 30 kDa
• AA Sequence: MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATAGGGGGCGRAKSRPGSPVLPPGAPKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LBX1 ladybird homeobox 1 [ Homo sapiens (human) ]
• Official Symbol: LBX1
• Synonyms: LBX1; ladybird homeobox 1; ladybird homeobox homolog 1 (Drosophila); transcription factor LBX1; HPX6; LBX1H; lady bird-like homeobox; ladybird homeobox homolog 1; ladybird homeobox protein homolog 1; transcription factor similar to D. melanogaster homeodomain protein lady bird late; HPX-6; homeobox
• Gene ID: 10660
• mRNA Refseq: NM_006562
• Protein Refseq: NP_006553
• MIM: 604255
• UniProt ID: P52954