Recombinant Human LBX1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LBX1-3351H
Product Overview : LBX1 MS Standard C13 and N15-labeled recombinant protein (NP_006553) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene and the orthologous mouse gene were found by their homology to the Drosophila lady bird early and late homeobox genes. In the mouse, this gene is a key regulator of muscle precursor cell migration and is required for the acquisition of dorsal identities of forelimb muscles.
Molecular Mass : 30 kDa
AA Sequence : MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATAGGGGGCGRAKSRPGSPVLPPGAPKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LBX1 ladybird homeobox 1 [ Homo sapiens (human) ]
Official Symbol LBX1
Synonyms LBX1; ladybird homeobox 1; ladybird homeobox homolog 1 (Drosophila); transcription factor LBX1; HPX6; LBX1H; lady bird-like homeobox; ladybird homeobox homolog 1; ladybird homeobox protein homolog 1; transcription factor similar to D. melanogaster homeodomain protein lady bird late; HPX-6; homeobox;
Gene ID 10660
mRNA Refseq NM_006562
Protein Refseq NP_006553
MIM 604255
UniProt ID P52954

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LBX1 Products

Required fields are marked with *

My Review for All LBX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon