Recombinant Human LARP1B Protein (1-201 aa), His-SUMO-tagged

• Cat.No.: LARP1B-1038H
• Product Overview: Recombinant Human LARP1B Protein (1-201 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Isoform 7.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• ProteinLength: 1-201 aa
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 40.1 kDa
• AA Sequence: MDSRDRGPGTSSVSTSNASPSEGAPLAGSYGCTPHSFPKFQHPSHELLKENGFTQQVYHKYRRRCLSERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAWEDAKENYRYGLECLFRFYSYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLKYSQSKTQSIDPKLQEYLCSFKRLEDFRVDEADPIE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: LARP1B La ribonucleoprotein domain family, member 1B [ Homo sapiens ]
• Official Symbol: LARP1B
• Synonyms: LARP1B; DKFZp434K245; DKFZp686E0316; FLJ10378; LARP2; MGC75174; MGC117277; DKFZp686L13217
• Gene ID: 55132
• mRNA Refseq: NM_018078
• Protein Refseq: NP_060548
• UniProt ID: Q659C4