Recombinant Human LARP1, His-tagged
Cat.No. : | LARP1-29045TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 679-1019 of Human LARP1 with an N terminal His tag. Predicted mwt: 40 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | 679-1019 a.a. |
Description : | LARP1 belongs to the LARP family and contains 1 HTH La-type RNA-binding domain. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 84 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GAPEPSTIARSLPTTVPESPNYRNTRTPRTPRTPQLKDSS QTSRFYPVVKEGRTLDAKMPRKRKTRHSSNPPLESHVG WVMDSREHRPRTASISSSPSEGTPTVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQE MNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRY GLECLFRYYSYGLEKKFRLDIFKDFQEETVKDYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVD PPMGEEGNHKRHSVVAGGGGGEGRKRCPSQSSSRPAAM ISQPPTPPTGQPVREDAKWTSQHSNTQTLGK |
Gene Name | LARP1 La ribonucleoprotein domain family, member 1 [ Homo sapiens ] |
Official Symbol | LARP1 |
Synonyms | LARP1; La ribonucleoprotein domain family, member 1; la-related protein 1; KIAA0731; LARP; MGC19556; |
Gene ID | 23367 |
mRNA Refseq | NM_015315 |
Protein Refseq | NP_056130 |
MIM | 612059 |
Uniprot ID | Q6PKG0 |
Chromosome Location | 5q33.2 |
Function | RNA binding; |
◆ Recombinant Proteins | ||
Extl2-2897M | Recombinant Mouse Extl2 Protein, Myc/DDK-tagged | +Inquiry |
SE2280-3124S | Recombinant Staphylococcus epidermidis ATCC 12228 SE2280 protein, His-tagged | +Inquiry |
INTS9-8253M | Recombinant Mouse INTS9 Protein | +Inquiry |
DMD-127HF | Recombinant Full Length Human DMD Protein | +Inquiry |
YSDC-1583B | Recombinant Bacillus subtilis YSDC protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
DDIM-6H | Native Human D-dimer protein | +Inquiry |
ALB-7995H | Native Human Serum Albumin(Protease Free) | +Inquiry |
IgM-344D | Native Donkey IgM | +Inquiry |
Immunoglobulin G-038S | Native Sheep Immunoglobulin G Protein | +Inquiry |
CKMB-256H | Active Native Human CKMB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PVALB-2658HCL | Recombinant Human PVALB 293 Cell Lysate | +Inquiry |
CLUL1-370HCL | Recombinant Human CLUL1 cell lysate | +Inquiry |
UGT2A3-1879HCL | Recombinant Human UGT2A3 cell lysate | +Inquiry |
GPR85-5774HCL | Recombinant Human GPR85 293 Cell Lysate | +Inquiry |
EPB41L3-562HCL | Recombinant Human EPB41L3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All LARP1 Products
Required fields are marked with *
My Review for All LARP1 Products
Required fields are marked with *
0
Inquiry Basket