Recombinant Human LANCL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LANCL1-3164H
Product Overview : LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_001130046) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme component in eukaryotic cells. Previously considered a member of the G-protein-coupled receptor superfamily, this protein is now in the LanC family. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Molecular Mass : 45.3 kDa
AA Sequence : MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LANCL1 LanC like 1 [ Homo sapiens (human) ]
Official Symbol LANCL1
Synonyms LANCL1; LanC lantibiotic synthetase component C-like 1 (bacterial); GPR69A, LanC (bacterial lantibiotic synthetase component C) like 1; lanC-like protein 1; p40; G protein-coupled receptor 69A; 40 kDa erythrocyte membrane protein; LanC (bacterial lantibiotic synthetase component); LanC (bacterial lantibiotic synthetase component C)-like 1; GPR69A;
Gene ID 10314
mRNA Refseq NM_001136574
Protein Refseq NP_001130046
MIM 604155
UniProt ID O43813

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LANCL1 Products

Required fields are marked with *

My Review for All LANCL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon