Recombinant Human LANCL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LANCL1-3164H
• Product Overview: LANCL1 MS Standard C13 and N15-labeled recombinant protein (NP_001130046) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: Myc&DDK
• Description: This gene encodes a loosely associated peripheral membrane protein related to the LanC family of bacterial membrane-associated proteins involved in the biosynthesis of antimicrobial peptides. This protein may play a role as a peptide-modifying enzyme component in eukaryotic cells. Previously considered a member of the G-protein-coupled receptor superfamily, this protein is now in the LanC family. Multiple alternatively spliced variants, encoding the same protein, have been identified.
• Molecular Mass: 45.3 kDa
• AA Sequence: MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGNYPPCIGDNRDLLVHWCHGAPGVIYMLIQAYKVFREEKYLCDAYQCADVIWQYGLLKKGYGLCHGSAGNAYAFLTLYNLTQDMKYLYRACKFAEWCLEYGEHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LANCL1 LanC like 1 [ Homo sapiens (human) ]
• Official Symbol: LANCL1
• Synonyms: LANCL1; LanC lantibiotic synthetase component C-like 1 (bacterial); GPR69A, LanC (bacterial lantibiotic synthetase component C) like 1; lanC-like protein 1; p40; G protein-coupled receptor 69A; 40 kDa erythrocyte membrane protein; LanC (bacterial lantibiotic synthetase component); LanC (bacterial lantibiotic synthetase component C)-like 1; GPR69A
• Gene ID: 10314
• mRNA Refseq: NM_001136574
• Protein Refseq: NP_001130046
• MIM: 604155
• UniProt ID: O43813