Recombinant Human LAMTOR3 protein, GST-tagged
Cat.No. : | LAMTOR3-3207H |
Product Overview : | Recombinant Human LAMTOR3 protein(Q9UHA4)(1-124aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-124aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.6 kDa |
AA Sequence : | MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | LAMTOR3 late endosomal/lysosomal adaptor, MAPK and MTOR activator 3 [ Homo sapiens ] |
Official Symbol | LAMTOR3 |
Synonyms | LAMTOR3; late endosomal/lysosomal adaptor, MAPK and MTOR activator 3; MAP2K1IP1, MAPK scaffold protein 1 , MAPKSP1, mitogen activated protein kinase kinase 1 interacting protein 1; ragulator complex protein LAMTOR3; MAPBP; MEK partner 1; MP1; Ragulator3; MEK binding partner 1; MAPK scaffold protein 1; mitogen-activated protein kinase scaffold protein 1; late endosomal/lysosomal adaptor and MAPK and MTOR activator 3; mitogen-activated protein kinase kinase 1 interacting protein 1; MAPKSP1; PRO0633; MAP2K1IP1; |
Gene ID | 8649 |
mRNA Refseq | NM_001243736 |
Protein Refseq | NP_001230665 |
MIM | 603296 |
UniProt ID | Q9UHA4 |
◆ Recombinant Proteins | ||
LAMTOR3-28221TH | Recombinant Human LAMTOR3, His-tagged | +Inquiry |
LAMTOR3-5066H | Recombinant Human Late Endosomal/Lysosomal Adaptor And MAPK And MTOR Activator 3, His-tagged | +Inquiry |
LAMTOR3-8945M | Recombinant Mouse LAMTOR3 Protein | +Inquiry |
LAMTOR3-5231H | Recombinant Human LAMTOR3 Protein (Met1-Ser124), His tagged | +Inquiry |
LAMTOR3-3352R | Recombinant Rat LAMTOR3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAMTOR3-4482HCL | Recombinant Human MAPKSP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LAMTOR3 Products
Required fields are marked with *
My Review for All LAMTOR3 Products
Required fields are marked with *
0
Inquiry Basket