Recombinant Human LAMTOR3 protein, GST-tagged

Source :	E. coli
Species :	Human
Tag :	GST
Form :	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass :	40.6 kDa
Protein length :	1-124aa
AA Sequence :	MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS
Purity :	Greater than 90% as determined by SDS-PAGE.
Storage :	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution :	Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Name	LAMTOR3 late endosomal/lysosomal adaptor, MAPK and MTOR activator 3 [ Homo sapiens ]
Official Symbol	LAMTOR3
Synonyms	LAMTOR3; late endosomal/lysosomal adaptor, MAPK and MTOR activator 3; MAP2K1IP1, MAPK scaffold protein 1 , MAPKSP1, mitogen activated protein kinase kinase 1 interacting protein 1; ragulator complex protein LAMTOR3; MAPBP; MEK partner 1; MP1; Ragulator3; MEK binding partner 1; MAPK scaffold protein 1; mitogen-activated protein kinase scaffold protein 1; late endosomal/lysosomal adaptor and MAPK and MTOR activator 3; mitogen-activated protein kinase kinase 1 interacting protein 1; MAPKSP1; PRO0633; MAP2K1IP1;
Gene ID	8649
mRNA Refseq	NM_001243736
Protein Refseq	NP_001230665
MIM	603296
UniProt ID	Q9UHA4