Recombinant Human LAMTOR3, His-tagged

Cat.No. : LAMTOR3-28221TH
Product Overview : Recombinant full length Human MAP2K1IP1 (amino acids 1-124) with N terminal His tag; 144 amino acids with tag, MWt 15.8 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 124 amino acids
Description : This gene encodes a scaffold protein that functions in the extracellular signal-regulated kinase (ERK) cascade. The protein is localized to late endosomes by the mitogen-activated protein-binding protein-interacting protein, and binds specifically to MAP kinase kinase MAP2K1/MEK1, MAP kinase MAPK3/ERK1, and MAP kinase MAPK1/ERK2. Studies of the orthologous gene in mouse indicate that it regulates late endosomal traffic and cell proliferation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome 13.
Conjugation : HIS
Molecular Weight : 15.800kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 5mM DTT, 20mM Tris HCl, 100mM Sodium chloride, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS
Gene Name LAMTOR3 late endosomal/lysosomal adaptor, MAPK and MTOR activator 3 [ Homo sapiens ]
Official Symbol LAMTOR3
Synonyms LAMTOR3; late endosomal/lysosomal adaptor, MAPK and MTOR activator 3; MAP2K1IP1, MAPK scaffold protein 1 , MAPKSP1, mitogen activated protein kinase kinase 1 interacting protein 1; ragulator complex protein LAMTOR3; MAPBP; MEK partner 1; MP1; Ragulator3
Gene ID 8649
mRNA Refseq NM_001243736
Protein Refseq NP_001230665
MIM 603296
Uniprot ID Q9UHA4
Chromosome Location 4q24-q26
Pathway MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem;
Function protein binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All LAMTOR3 Products

Required fields are marked with *

My Review for All LAMTOR3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon