Recombinant Human LAMTOR3, His-tagged

• Cat.No.: LAMTOR3-28221TH
• Product Overview: Recombinant full length Human MAP2K1IP1 (amino acids 1-124) with N terminal His tag; 144 amino acids with tag, MWt 15.8 kDa.

Specification

• Description: This gene encodes a scaffold protein that functions in the extracellular signal-regulated kinase (ERK) cascade. The protein is localized to late endosomes by the mitogen-activated protein-binding protein-interacting protein, and binds specifically to MAP kinase kinase MAP2K1/MEK1, MAP kinase MAPK3/ERK1, and MAP kinase MAPK1/ERK2. Studies of the orthologous gene in mouse indicate that it regulates late endosomal traffic and cell proliferation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. A pseudogene of this gene is located on the long arm of chromosome 13.
• Protein length: 124 amino acids
• Conjugation: HIS
• Molecular Weight: 15.800kDa inclusive of tags
• Source: E. coli
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 20% Glycerol, 5mM DTT, 20mM Tris HCl, 100mM Sodium chloride, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS

Gene Information

• Gene Name: LAMTOR3 late endosomal/lysosomal adaptor, MAPK and MTOR activator 3 [ Homo sapiens ]
• Official Symbol: LAMTOR3
• Synonyms: LAMTOR3; late endosomal/lysosomal adaptor, MAPK and MTOR activator 3; MAP2K1IP1, MAPK scaffold protein 1 , MAPKSP1, mitogen activated protein kinase kinase 1 interacting protein 1; ragulator complex protein LAMTOR3; MAPBP; MEK partner 1; MP1; Ragulator3
• Gene ID: 8649
• mRNA Refseq: NM_001243736
• Protein Refseq: NP_001230665
• MIM: 603296
• Uniprot ID: Q9UHA4
• Chromosome Location: 4q24-q26
• Pathway: MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; MAPK signaling pathway, conserved biosystem
• Function: protein binding