Recombinant Human LAMC2 protein, His-GST & Myc-tagged

• Cat.No.: LAMC2-4402H
• Product Overview: Recombinant Human LAMC2 protein(Q13753)(417-588aa), fused to N-terminal His-GST tag and C-terminal Myc tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His&Myc
• Protein Length: 417-588aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 53.3 kDa
• AA Sequence: NCQGGGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVVCNNCPPGVTGARCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSASGNCDRLTGRCLKCIHNTAGIYCDQCKAGYFGDPLAPNPADKCRACNCNPMGSEPVGCRSD
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: LAMC2 laminin, gamma 2 [ Homo sapiens ]
• Official Symbol: LAMC2
• Synonyms: LAMC2; laminin, gamma 2; EBR2, EBR2A, LAMB2T, laminin, gamma 2 (nicein (100kD), kalinin (105kD), BM600 (100kD), Herlitz junctional epidermolysis bullosa)) , LAMNB2; laminin subunit gamma-2; BM600 100kDa; kalinin 105kDa; nicein 100kDa; BM600-100kDa; laminin B2t chain; CSF 140 kDa subunit; nicein subunit gamma; kalinin subunit gamma; ladsin 140 kDa subunit; epiligrin subunit gamma; cell-scattering factor 140 kDa subunit; large adhesive scatter factor 140 kDa subunit; B2T; CSF; EBR2; BM600; EBR2A; LAMB2T; LAMNB2; MGC138491; MGC141938
• Gene ID: 3918
• mRNA Refseq: NM_005562
• Protein Refseq: NP_005553
• MIM: 150292
• UniProt ID: Q13753