Recombinant Human LALBA

• Cat.No.: LALBA-27311TH
• Product Overview: Recombinant fragment of Human alpha Lactalbumin with a N terminal proprietary tag; Predicted MW 37.73 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 110 amino acids
• Description: This gene encodes alpha-lactalbumin, a principal protein of milk. Alpha-lactalbumin forms the regulatory subunit of the lactose synthase (LS) heterodimer and beta 1,4-galactosyltransferase (beta4Gal-T1) forms the catalytic component. Together, these proteins enable LS to produce lactose by transfering galactose moieties to glucose. As a monomer, alpha-lactalbumin strongly binds calcium and zinc ions and may possess bactericidal or antitumor activity. A folding variant of alpha-lactalbumin, called HAMLET, likely induces apoptosis in tumor and immature cells.
• Molecular Weight: 37.730kDa inclusive of tags
• Tissue specificity: Mammary gland specific. Secreted in milk.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: DIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLF QISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAK KILDIKGIDYWLAHKALCTEKLEQWLCEKL
• Sequence Similarities: Belongs to the glycosyl hydrolase 22 family.

Gene Information

• Gene Name: LALBA lactalbumin, alpha- [ Homo sapiens ]
• Official Symbol: LALBA
• Synonyms: LALBA; lactalbumin, alpha-; alpha-lactalbumin; LYZL7
• Gene ID: 3906
• mRNA Refseq: NM_002289
• Protein Refseq: NP_002280
• MIM: 149750
• Uniprot ID: P00709
• Chromosome Location: 12q13
• Pathway: Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem
• Function: calcium ion binding; lactose synthase activity