Recombinant Human LALBA Protein, His-tagged
Cat.No. : | LALBA-306H |
Product Overview : | Recombinant Human LALBA fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | THis gene encodes alpha-lactalbumin, a principal protein of milk. Alpha-lactalbumin forms the regulatory subunit of the lactose synthase (LS) heterodimer and beta 1,4-galactosyltransferase (beta4Gal-T1) forms the catalytic component. Together, these proteins enable LS to produce lactose by transfering galactose moieties to glucose. As a monomer, alpha-lactalbumin strongly binds calcium and zinc ions and may possess bactericidal or antitumor activity. A folding variant of alpha-lactalbumin, called HAMLET, likely induces apoptosis in tumor and immature cells. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM Tris, 150mM NaCl, pH 8.0 |
Molecular Mass : | 15.1kD |
AA Sequence : | KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKLVDHHHHHH* |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | LALBA lactalbumin, alpha- [ Homo sapiens ] |
Official Symbol | LALBA |
Synonyms | LALBA; lactalbumin, alpha-; alpha-lactalbumin; LYZL7; lysozyme-like protein 7; lactose synthase B protein; MGC138521; MGC138523; |
Gene ID | 3906 |
mRNA Refseq | NM_002289 |
Protein Refseq | NP_002280 |
MIM | 149750 |
UniProt ID | P00709 |
◆ Recombinant Proteins | ||
LALBA-3002R | Recombinant Rat LALBA Protein, His (Fc)-Avi-tagged | +Inquiry |
LALBA-705H | Recombinant Human LALBA Protein, Fc-tagged | +Inquiry |
LALBA-3372C | Recombinant Capra hircus (Goat) LALBA, His-tagged | +Inquiry |
LALBA-4979M | Recombinant Mouse LALBA Protein, His (Fc)-Avi-tagged | +Inquiry |
LALBA-4410H | Recombinant Human LALBA Protein (Lys20-Lys141), N-His tagged | +Inquiry |
◆ Native Proteins | ||
LALBA-8173H | Native Human Lactalbumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
LALBA-4829HCL | Recombinant Human LALBA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LALBA Products
Required fields are marked with *
My Review for All LALBA Products
Required fields are marked with *
0
Inquiry Basket