Recombinant Human LALBA Protein, His-tagged

• Cat.No.: LALBA-306H
• Product Overview: Recombinant Human LALBA fused with His tag at C-terminal was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Description: THis gene encodes alpha-lactalbumin, a principal protein of milk. Alpha-lactalbumin forms the regulatory subunit of the lactose synthase (LS) heterodimer and beta 1,4-galactosyltransferase (beta4Gal-T1) forms the catalytic component. Together, these proteins enable LS to produce lactose by transfering galactose moieties to glucose. As a monomer, alpha-lactalbumin strongly binds calcium and zinc ions and may possess bactericidal or antitumor activity. A folding variant of alpha-lactalbumin, called HAMLET, likely induces apoptosis in tumor and immature cells.
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM Tris, 150mM NaCl, pH 8.0
• Molecular Mass: 15.1kD
• AA Sequence: KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKLVDHHHHHH*
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: LALBA lactalbumin, alpha- [ Homo sapiens ]
• Official Symbol: LALBA
• Synonyms: LALBA; lactalbumin, alpha-; alpha-lactalbumin; LYZL7; lysozyme-like protein 7; lactose synthase B protein; MGC138521; MGC138523
• Gene ID: 3906
• mRNA Refseq: NM_002289
• Protein Refseq: NP_002280
• MIM: 149750
• UniProt ID: P00709