Recombinant Human KXD1 Protein, GST-tagged

• Cat.No.: KXD1-4332H
• Product Overview: Human MGC2749 full-length ORF ( NP_076974.1, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: KXD1 (KxDL Motif Containing 1) is a Protein Coding gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 46 kDa
• AA Sequence: MDLPDSASRVFCGRILSMVNTDDVNAIILAQKNMLDRFEKTNEMLLNFNNLSSARLQQMSERFLHHTRTLVEMKRDLDSIFRRIRTLKGKLARQHPEAFSHIPEASFLEEEDEDPIPPSTTTTIATSEQSTGSCDTSPDTVSPSLSPGFEDLSHVQAGSPAINGRSQTDDEEMTGE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KXD1 KxDL motif containing 1 [ Homo sapiens (human) ]
• Official Symbol: KXD1
• Synonyms: KXD1; KxDL motif containing 1; KXDL; BORCS4; MST096; MSTP096; C10orf50; C19orf50; kxDL motif-containing protein 1; UPF0459 protein C19orf50
• Gene ID: 79036
• mRNA Refseq: NM_001171948
• Protein Refseq: NP_001165419
• MIM: 615178
• UniProt ID: Q9BQD3