Recombinant Human KU-MEL-3 Protein, GST-tagged

• Cat.No.: KU-MEL-3-4787H
• Product Overview: Human KU-MEL-3 full-length ORF ( ADR83454.1, 1 a.a. - 58 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 1-58 a.a.
• Description: KU-MEL-3 (Uncharacterized LOC497048) is an RNA Gene, and is affiliated with the ncRNA class.
• Molecular Mass: 6.4 kDa
• AA Sequence: MLPRTPRPDLILLQLLPAGLRPPDLQAPYPPAGLCSTLIFVPCFQSCQASGSLSLTSP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KU-MEL-3 uncharacterized LOC497048 [ Homo sapiens (human) ]
• Official Symbol: KU-MEL-3
• Synonyms: KU-MEL-3; uncharacterized LOC497048
• Gene ID: 497048