Recombinant Human KRTCAP2 Protein, GST-tagged
| Cat.No. : | KRTCAP2-4800H |
| Product Overview : | Human KRTCAP2 full-length ORF ( NP_776251.1, 1 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | KRTCAP2 (Keratinocyte Associated Protein 2) is a Protein Coding gene. |
| Source : | Wheat Germ |
| Species : | Human |
| Tag : | GST |
| Molecular Mass : | 44 kDa |
| AA Sequence : | MRIANRTRFSSPFLARGAGWTHGRGMMVVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAAPVLTPAKVTGKSKKRN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KRTCAP2 keratinocyte associated protein 2 [ Homo sapiens ] |
| Official Symbol | KRTCAP2 |
| Synonyms | KRTCAP2; keratinocyte associated protein 2; keratinocyte-associated protein 2; KCP2; KCP-2; keratinocytes associated protein 2; |
| Gene ID | 200185 |
| mRNA Refseq | NM_173852 |
| Protein Refseq | NP_776251 |
| UniProt ID | Q8N6L1 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KRTCAP2 Products
Required fields are marked with *
My Review for All KRTCAP2 Products
Required fields are marked with *
0
Inquiry Basket
