Recombinant Full Length Human KRTCAP2 Protein, GST-tagged

Cat.No. : KRTCAP2-5834HF
Product Overview : Human KRTCAP2 full-length ORF ( NP_776251.1, 1 a.a. - 162 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 162 amino acids
Description : KRTCAP2 (Keratinocyte Associated Protein 2) is a Protein Coding gene.
Molecular Mass : 44 kDa
AA Sequence : MRIANRTRFSSPFLARGAGWTHGRGMMVVGTGTSLALSSLLSLLLFAGMQMYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQAAAPVLTPAKVTGKSKKRN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KRTCAP2 keratinocyte associated protein 2 [ Homo sapiens ]
Official Symbol KRTCAP2
Synonyms KRTCAP2; keratinocyte associated protein 2; keratinocyte-associated protein 2; KCP2; KCP-2; keratinocytes associated protein 2;
Gene ID 200185
mRNA Refseq NM_173852
Protein Refseq NP_776251
MIM 619029
UniProt ID Q8N6L1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All KRTCAP2 Products

Required fields are marked with *

My Review for All KRTCAP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon