Recombinant Human KRTAP3-3 Protein, GST-tagged

• Cat.No.: KRTAP3-3-4813H
• Product Overview: Human KRTAP3-3 full-length ORF ( NP_149441.1, 1 a.a. - 98 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 1-98 a.a.
• Description: This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the high sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. [provided by RefSeq
• Molecular Mass: 36.8 kDa
• AA Sequence: MDCCASRGCSVPTGPATTICSSDKSCRCGVCLPSTCPHTVWLLEPTCCDNCPPPCHIPQPCVPTCFLLNSCQPTPGLETLNLTTFTQPCCEPCLPRGC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KRTAP3-3 keratin associated protein 3-3 [ Homo sapiens (human) ]
• Official Symbol: KRTAP3-3
• Synonyms: KRTAP3-3; keratin associated protein 3-3; KAP3.3; KRTAP3.3; keratin-associated protein 3-3; high sulfur keratin-associated protein 3.3; keratin-associated protein 3.3
• Gene ID: https://www.ncbi.nlm.nih.gov/gene/?term=85293
• mRNA Refseq: NM_033185
• Protein Refseq: NP_149441
• UniProt ID: Q9BYR6