Recombinant Human KRTAP26-1 Protein, GST-tagged

• Cat.No.: KRTAP26-1-4815H
• Product Overview: Human KRTAP26-1 full-length ORF (AAH57825.1, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-210 a.a.
• Description: KRTAP26-1 (Keratin Associated Protein 26-1) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology.
• Molecular Mass: 49.5 kDa
• AA Sequence: MSCPNYCSGNSNSGSLRTSRHIPLTSIDLCPTSVSCGDVLYLPTSSQDHTWVTDNCQETCGEPTSCQPVHCETGNLETSCGSSTAYYVPRPCQGSSFLPASFFSSSCLPVSCRPQRYVSSGCRPLRPLLNSYQPIGDCVPNAYRPQFCLSKSCQPQNLLTSGCQPSSCLAYRPQSLHVVSSSLRPLGPLFSGCQPLTHVFSTCRPSCSGL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KRTAP26-1 keratin associated protein 26-1 [ Homo sapiens (human) ]
• Official Symbol: KRTAP26-1
• Synonyms: KRTAP26-1; keratin associated protein 26-1; keratin-associated protein 26-1
• Gene ID: 388818
• mRNA Refseq: NM_203405
• Protein Refseq: NP_981950
• UniProt ID: Q6PEX3