Recombinant Human KRTAP10-6 Protein, GST-tagged

• Cat.No.: KRTAP10-6-4827H
• Product Overview: Human KRTAP10-6 full-length ORF ( AAI60131.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: KRTAP10-6 (Keratin Associated Protein 10-6) is a Protein Coding gene. Among its related pathways are Keratinization and Developmental Biology. An important paralog of this gene is KRTAP10-7.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 40.2 kDa
• AA Sequence: MAASTMSVCSSDLSYGSRVCLPGSCDSCSDSWQVDDCPESCCEPPCCAPAPCLSLVCTPVSRVSSPCCPVTCEPSPCQSGCTSSCTPSCCQQSSCQLACCASSPCQQACCVPVCCKTVCCKPVCCVSVCCGDSSCCQQSSCQSACCTSSPCQQACCVPVCCKPVCSGISSSCCQQSSCVSCVSSPCCQAVCEPSPCQSGCTSSCTPSCCQQSSCQPTCCTSSPCQQACCVPVCCVPVCCVPTCSEDSSSCCQQSSCQPACCTSSPCQHACCVPVCSGASTSCCQQSSCQPACCTASCCRPSSSVSLLCHPVCKSTCCVPVPSCGASASSCQPSCCRTASCVSLLCRPMCSRPACYSLCSGQKSSC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Protein length: 1-365 a.a.

Gene Information

• Gene Name: KRTAP10-6 keratin associated protein 10-6 [ Homo sapiens (human) ]
• Official Symbol: KRTAP10-6
• Synonyms: KRTAP10-6; keratin associated protein 10-6; KAP10.6; KAP18.6; KRTAP18-6; KRTAP18.6; keratin-associated protein 10-6; high sulfur keratin-associated protein 10.6; keratin associated protein 18-6
• Gene ID: 386674
• mRNA Refseq: NM_198688
• Protein Refseq: NP_941961
• UniProt ID: P60371